The Puckette/Dennis and Griewank/Linnainmaa-Speelpenning argument-from-silence checks bridge only at the vault's own method level — no object-level connection located between Max/MSP's dataflow history and automatic differentiation's citation-credit history

argument-from-silencenegative-citationbridge-investigationjack-dennismax-mathewsmiller-puckettegriewanklinnainmaaspeelpenningdataflowretrievalepistemicsmeta-vaultcross-domain-bridge

A cosine-0.88, unlinked pairing between claim-puckette-max-origins-cite-no-dataflow-ancestor (Puckette's own retrospective on Max's design names no academic dataflow-computation ancestor) and claim-griewanks-name-reaches-differentiable-physics-literature-further-than-linnainmaas-or-speelpennings (Griewank's name reaches modern differentiable-physics citation practice; Linnainmaa's and Speelpenning's do not) connects at only one level. The two notes' real-world subjects — computer-music visual-programming history; automatic-differentiation citation-credit history — share no person, document, or event. What they share is a method the vault has already named and actively grades: moc-argument-from-silence's argument from silence / negative-citation cluster, under McGrew's notice × record × survive product (claim-mcgrew-argument-from-silence-is-notice-record-survive-product). This is a third independent instance of a shape the vault has already found twice — observation-brooks-dreyfus-kodosky-dennis-share-method-not-evidentiary-strength (robotics/phenomenology and dataflow-programming/dataflow-theory) and observation-pitman-ossietzky-bridges-share-genre-not-object-level-connection (two unrelated person-bridges) — each finding a real connective document (the MOC, or the genre itself) that never ties the specific target notes together by any fact in the world either describes.

A direct search for an object-level connection between Jack Dennis's MIT dataflow-computation program and the Linnainmaa/Speelpenning/Griewank automatic-differentiation lineage found no shared person, paper, or event. The one plausible candidate was checked directly rather than left unexamined: Edward A. Lee and David Messerschmitt's 1987 synchronous dataflow (SDF) model, which does descend from Dennis's dataflow-architecture work and sits closest to the domain Max/MSP's own audio engine actually operates in, per Puckette's own statement that "for audio computations, dataflow semantics are more appropriate than the message-passing model that Max adopts for control calculations." SDF's own line of work (Lee, Messerschmitt, Bhattacharyya, Buck, Ha) stayed inside digital-signal-processing scheduling and the Ptolemy project; nothing located ties it to automatic differentiation or to music software specifically. This is a historical/negative claim resting on targeted search coverage, not an exhaustive primary read of either lineage's full literature — [unverified — could not confirm or deny after search] is the honest ceiling, though the search traced the one real candidate bridge to its dead end rather than stopping at a cursory pass.