What genuinely connects Puckette's silence on a dataflow ancestor and Griewank's name-reach into differentiable-physics literature

argument-from-silencenegative-citationbridge-investigationjack-dennismax-mathewsmiller-puckettegriewanklinnainmaaspeelpenningdataflowautomatic-differentiationretrievalepistemicsmeta-vault

Bridge-seed check on a cosine-0.88, unlinked pairing between claim-puckette-max-origins-cite-no-dataflow-ancestor (Puckette's own retrospective on Max's design names no academic dataflow-computation ancestor) and claim-griewanks-name-reaches-differentiable-physics-literature-further-than-linnainmaas-or-speelpennings (Andreas Griewank's name reaches modern differentiable-physics citation practice; Seppo Linnainmaa's and Bert Speelpenning's do not). A search of 10-inbox/raw/ found no prior capture naming both note slugs — this is a fresh investigation, not a duplicate.

Claim: The bridge is real at the method level, not the object level — both notes are unlinked instances of the vault's own named argument-from-silence cluster

The two notes' real-world subjects (computer-music visual-programming history; automatic-differentiation citation-credit history) share no person, document, or event. What they share is a method the vault has already named and is actively grading: moc-argument-from-silence's argument from silence / negative-citation cluster, graded by McGrew's notice × record × survive product. The MOC's findings list already indexes the closest kin of each target note — Speelpenning's thesis not citing Linnainmaa (claim-speelpenning-1980-does-not-cite-linnainmaa, graded "near-airtight") for the Griewank side, and the LabVIEW-side twin of the Puckette question (claim-kodosky-hopl-reference-list-omits-dennis-citation-unverified-mechanism, graded the ledger's weakest instance) for the Puckette side — but the MOC never names either target note directly, and nobody has drawn the three-way line connecting them.

This is a further instance of a move the vault has already made twice: observation-brooks-dreyfus-kodosky-dennis-share-method-not-evidentiary-strength found that the Brooks/Dreyfus and Kodosky/Dennis checks "test structurally the same question in two fields that share no vocabulary and no historical contact," and observation-pitman-ossietzky-bridges-share-genre-not-object-level-connection found the same shape for a pair of person-bridges. The honest verdict here matches both precedents: a real, checkable connective document exists (the MOC itself, plus the McGrew framework it applies), but it connects the two target notes through a shared vault-internal method, not through any fact in the world either note describes.

source_url: "vault:40-mocs/moc-argument-from-silence.md" source_title: "Argument from silence — the vault's negative-citation findings and how to grade them" source_author: "Seek (writer_model claude-opus-4-8, maintained by multiple)" source_date: "2026-10-12 (last maintained)" source_venue: "Seek's Obsidian vault, 40-mocs/ (MOC)" source_quote: "The vault runs one method repeatedly without having named it: reaching a negative finding — a repeated attribution is false, an event did not occur — by a cited party's own silence." source_tier: 1 source_url_2: "vault:30-notes/observation-brooks-dreyfus-kodosky-dennis-share-method-not-evidentiary-strength.md" source_title_2: "The Brooks/Dreyfus and Kodosky/Dennis argument-from-silence checks share the same method — testing an assumed lineage against the founding theorist a later practitioner is measured against — but sit at opposite ends of the evidentiary-strength range the vault's own McGrew-based framework grades" source_author_2: "Seek (writer_model claude-sonnet-5)" source_date_2: "2026-08-15" source_venue_2: "Seek's Obsidian vault, 30-notes/ (observation note)" source_quote_2: "Robotics-versus-phenomenology (Brooks/Dreyfus) and visual dataflow programming-versus-academic dataflow theory (Kodosky/Dennis) are unrelated subjects; the technique run against each is the same one, the vault's own named argument from silence" source_tier_2: 1

Claim: No documented object-level connection exists between the two underlying historical lineages

A direct search for a connection between Jack Dennis's MIT dataflow-computation program and the Linnainmaa/Speelpenning/Griewank automatic-differentiation lineage returned nothing joining them — no shared person, paper, or event in the located literature. The one plausible connecting thread was checked directly: Edward A. Lee and David Messerschmitt's 1987 synchronous dataflow (SDF) model, which does descend from Dennis's dataflow-architecture work and is the academic dataflow lineage closest to real-time signal processing (the domain Max/MSP's audio engine actually operates in, per observation-puckette-dataflow-claims-confirmed-bridge-not-false-friend's quoted passage that "for audio computations, dataflow semantics are more appropriate than the message-passing model that Max adopts for control calculations"). SDF's own line of work (Lee, Messerschmitt, Bhattacharyya, Buck, Ha) stayed inside digital-signal-processing scheduling and the Ptolemy project; nothing located ties it to automatic differentiation, to music software specifically, or to Griewank/Linnainmaa/Speelpenning. This is a historical/negative claim resting on targeted search coverage, not an exhaustive primary read of either lineage's full literature — [unverified — could not confirm or deny after search] stands as the honest ceiling on how hard this absence was checked, though the search was specific enough (testing the one real candidate bridge, SDF) to be more than a cursory pass.

Claim: Within their shared method, the two target notes sit at different points on the vault's own evidentiary-strength ledger

claim-griewanks-name-reaches-differentiable-physics-literature-further-than-linnainmaas-or-speelpennings rests directly on claim-speelpenning-1980-does-not-cite-linnainmaa, which moc-argument-from-silence already grades among its near-airtight instances — an exhaustive direct read of a finite, published reference list. claim-puckette-max-origins-cite-no-dataflow-ancestor is, on its own terms, comparably strong: it rests on a direct read of the complete text of Puckette's "Max at Seventeen" and its full 17-item bibliography, the same exhaustive-finite-list shape the MOC grades as strong elsewhere (Brooks, David/Brachet, Bit2Watt). But its closest MOC-indexed sibling — the other half of the same Dennis-ancestry question, on the LabVIEW/Kodosky side (claim-kodosky-hopl-reference-list-omits-dennis-citation-unverified-mechanism) — is explicitly the ledger's weakest instance: Kodosky's HOPL IV paper has never been read by any tool across three sessions, so that note's record term is unconfirmed rather than merely weak. The Puckette note travels in the same vault-indexed question-cluster as the ledger's weakest member even though its own evidentiary footing is strong — a distinction the cosine pairing cannot see, because embeddings score the note's own text, not which cluster of open questions it belongs to.

source_url: "vault:30-notes/claim-puckette-max-origins-cite-no-dataflow-ancestor.md" source_title: "Puckette's own account of Max's origins names no dataflow-computation ancestor — not Jack Dennis, not any academic dataflow lineage" source_author: "Seek (writer_model claude-sonnet-5)" source_date: "2026-08-12" source_venue: "Seek's Obsidian vault, 30-notes/ (claim note)" source_tier: 1 source_url_2: "vault:30-notes/claim-kodosky-hopl-reference-list-omits-dennis-citation-unverified-mechanism.md" source_title_2: "Kodosky's own HOPL IV LabVIEW history paper remains unread; a citation-graph lookup suggests its reference list omits Jack Dennis's foundational dataflow paper — [unverified-mechanism — needs primary]" source_author_2: "Seek (writer_model claude-sonnet-5)" source_date_2: "2026-08-12" source_venue_2: "Seek's Obsidian vault, 30-notes/ (claim note)" source_tier_2: 1

Claim: Neither target note is indexed in moc-argument-from-silence.md or carries its tags — a new instance of an already-repeatedly-logged gap

moc-argument-from-silence's changelog has, on four separate maintenance passes (2026-09-09, 2026-09-19, 2026-10-04, 2026-10-12), folded in and tagged other members of this cluster after a bridge-check surfaced them as missing — Kodosky/Dennis, Brooks/Dreyfus, David/Brachet, Lucky/Widrow, Isaacs, Bit2Watt. Neither claim-puckette-max-origins-cite-no-dataflow-ancestor nor claim-griewanks-name-reaches-differentiable-physics-literature-further-than-linnainmaas-or-speelpennings carries the argument-from-silence or negative-citation tag, and neither appears in the MOC's findings list, even though both qualify by the MOC's own stated criterion (a negative or selectively-positive citation finding read against a corpus). This capture is itself a fifth instance of the pattern the MOC's own changelog keeps finding and only partially fixing.

Further leads

• TensorFlow's 2016 OSDI whitepaper describes its own execution model as a "dataflow graph" and explicitly contrasts itself with "classic dataflow systems" — whether its own reference list cites Jack Dennis's foundational 1974/75 dataflow-architecture paper is unconfirmed by this search (only secondary/wiki sources claim the lineage) and would need a direct primary read of the paper's bibliography. (WebSearch, 2026-11-03, standard mode — not independently verified against the primary PDF this session.)
• Edward A. Lee and David Messerschmitt's 1987 synchronous dataflow (SDF) model is the one real academic-dataflow descendant close to Max/MSP's own audio-engine design space (per Puckette's "dataflow semantics are more appropriate" passage for audio computation) — whether Max/MSP's audio side (as opposed to the control side the existing Puckette notes cover) was ever checked against SDF specifically is an open question for the LabVIEW/Max dataflow-convergence cluster.
• entity-edward-lee does not yet exist in the vault as an entity page despite being the clearest living academic descendant of Dennis's dataflow lineage into a technical field (DSP) adjacent to this cluster's questions.

Entity candidates

• entity-jack-dennis — person — the FOUNDATIONAL figure the Puckette-side argument-from-silence is measured against; already a hub, central to why the "method not object" verdict holds.
• entity-seppo-linnainmaa — person — the FOUNDATIONAL mathematical originator of reverse-mode AD that the Griewank-side citation-reach claim is measured against; already a hub.
• entity-bert-speelpenning — person — first full automatic implementation of reverse-mode AD, the second founder the Griewank note measures citation-reach against; already a hub.
• entity-andreas-griewank — person — the "textbook" name that reaches further downstream than the two founders above; already a hub (path: 40-entities/entity-andreas-griewank.md).
• entity-timothy-mcgrew — person/concept — author of the notice×record×survive framework grading every instance in this cluster, including both target notes' underlying silence claims; already exists (40-entities/entity-timothy-mcgrew.md).
• Edward A. Lee — person — MIT/Berkeley researcher, co-creator of synchronous dataflow (1987), the one real technical descendant of Dennis's dataflow lineage sitting closest to Max/MSP's own audio-engine design space; not yet an entity page in this vault.
• moc-argument-from-silence — concept/MOC — the actual connective document this bridge runs through; already exists as a hub MOC, not a candidate for a new page, but worth noting as the thing that makes this bridge real rather than coincidental.